PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g72960.1.p
Common NameBRADI_1g72960, LOC100842793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 240aa    MW: 26292.1 Da    PI: 9.5648
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g72960.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.91.6e-33132188158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh hA++R+Rg+gGrF
  Bradi1g72960.1.p 132 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHLHAMKRARGTGGRF 188
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.3E-38130191IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.916131191IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.0E-29133188IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-24134156IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860136156IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-24165188IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MRRKEDMHEN GTIMIQFGHQ VPNYDSSASD SPQEVSGMSE GSHNEQNEQS GRRDGYTNSD  60
EGKMMSALSL GNSETTYAQP KPDRTHPFAV AYPYADPFYG GAYGSHAVMH PQIVGMVPSS  120
RVPLPIEQAA AEEPIYVNAK QYHAILRRRQ LRAKLEAENK LVKSRKPYLH ESRHLHAMKR  180
ARGTGGRFLN SKQQPEGSSG SDASTRAGHS GIPANGGMFS KHDHTLSSGD LQYRVRGGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-23132194264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754217.11e-178PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLA0A0Q3HKF31e-178A0A0Q3HKF3_BRADI; Uncharacterized protein
STRINGBRADI1G72960.11e-177(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.15e-42nuclear factor Y, subunit A6